(data stored in ACNUC5340 zone)

EMBL: CP000828.PE307

CP000828.PE307       Location/Qualifiers
FT   CDS             complement(311477..312157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0338"
FT                   /product="peptidase M23 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25398"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9V8"
FT                   /protein_id="ABW25398.1"
FT                   /translation="MSLSLACGLGSGCSLLSVRPAPSMPEGGAFPDPPTSMPSLLLNRL
FT                   GVKQWFDNRRGTHPLTDLPSTAMKGYCHPLQGKGFLSQGTRGNTHQGRMKYAYDFGVPI
FT                   GMPVYAMQGGRVIGLRDKYPDKGGRRRNAEKFNFIWLEHSNGVRSAYIHLQQNFKKKIP
FT                   IKLNDWVRTGDLIGYSGNSGWSSAPHLHVEVHSISESGFGQTLPFEIVSKCHNTPFASV
FT                   RQAS"
     MSLSLACGLG SGCSLLSVRP APSMPEGGAF PDPPTSMPSL LLNRLGVKQW FDNRRGTHPL        60
     TDLPSTAMKG YCHPLQGKGF LSQGTRGNTH QGRMKYAYDF GVPIGMPVYA MQGGRVIGLR       120
     DKYPDKGGRR RNAEKFNFIW LEHSNGVRSA YIHLQQNFKK KIPIKLNDWV RTGDLIGYSG       180
     NSGWSSAPHL HVEVHSISES GFGQTLPFEI VSKCHNTPFA SVRQAS                      226
//

If you have problems or comments...

PBIL Back to PBIL home page