(data stored in ACNUC27125 zone)

EMBL: CP000828.PE31

CP000828.PE31        Location/Qualifiers
FT   CDS             complement(35904..37004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0034"
FT                   /product="periplasmic solute-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25122"
FT                   /db_xref="GOA:B0C510"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:B0C510"
FT                   /protein_id="ABW25122.1"
FT                   /translation="MNVNKKKSFPFRKLAITSVVAIVAIASGVGGGGWYWWQSAIAPVE
FT                   KNAQPSQELLQVQIPEGASANEIGQILEEAGLIRSITAWKVWTRWQGLWESSGGFHAGT
FT                   YQLSPQASMADIAQTIWSGKVQQVSFTVPEGWTQKQMANYFEELGWFSAQEFLDATNNI
FT                   PRDRYPWLPEDIPFLEGYLFPDTYQISVDQRTPEAVIGVMLNHFEASALPVYKNRTGYT
FT                   DLSLDDWVTLASIVEKESVVAEERARIAGVFWNRLRDNITLGSDPTVEYGLGITQTPDQ
FT                   PLTYAQVETPSPYNTYINAGLTPTPIASPGLASLKATVSPEKTDFLYFVARYDGTHVFS
FT                   RTLTEHLRAQAKIRDQQDAKQNSTNL"
     MNVNKKKSFP FRKLAITSVV AIVAIASGVG GGGWYWWQSA IAPVEKNAQP SQELLQVQIP        60
     EGASANEIGQ ILEEAGLIRS ITAWKVWTRW QGLWESSGGF HAGTYQLSPQ ASMADIAQTI       120
     WSGKVQQVSF TVPEGWTQKQ MANYFEELGW FSAQEFLDAT NNIPRDRYPW LPEDIPFLEG       180
     YLFPDTYQIS VDQRTPEAVI GVMLNHFEAS ALPVYKNRTG YTDLSLDDWV TLASIVEKES       240
     VVAEERARIA GVFWNRLRDN ITLGSDPTVE YGLGITQTPD QPLTYAQVET PSPYNTYINA       300
     GLTPTPIASP GLASLKATVS PEKTDFLYFV ARYDGTHVFS RTLTEHLRAQ AKIRDQQDAK       360
     QNSTNL                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page