(data stored in ACNUC5340 zone)

EMBL: CP000828.PE311

CP000828.PE311       Location/Qualifiers
FT   CDS             315739..315960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0343"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25402"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9W2"
FT                   /protein_id="ABW25402.1"
FT                   /translation="MRRVGNLWPQIIAFQNLIQAARQAQKGKRYRANVLQFNHHLETEL
FT                   FTIQSELATQTYTPGPYRTFEIFEGVVA"
     MRRVGNLWPQ IIAFQNLIQA ARQAQKGKRY RANVLQFNHH LETELFTIQS ELATQTYTPG        60
     PYRTFEIFEG VVA                                                           73
//

If you have problems or comments...

PBIL Back to PBIL home page