(data stored in ACNUC27125 zone)

EMBL: CP000828.PE315

CP000828.PE315       Location/Qualifiers
FT   CDS             complement(318828..319667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25406"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9W6"
FT                   /protein_id="ABW25406.1"
FT                   /translation="MSAKINQLKSLALGGVLALSMAPAINAQTLHQRTFSQRPLKTQKF
FT                   SCGRHLKTFVVRSLNRQRGRGIRCVKVSTVRRGSRRLPKIAWYGEGNWNGKSYRHVGHA
FT                   FGNRRLMRGYASDIYGNGEHFKNNFPGNLRVRMISPSRIQVTGAWNEEWIQVRTTQYQP
FT                   LRRARTCGKFFDQYRVADLIAPPKGRQGRGLRCVLKVGPQGSYAPKRYFTTWFGNGQWG
FT                   QSTYSHLGTRSLKGAGASDICGSVFGPVCNHFNYGSLKIKPVGNGFNVVGAWREMWR"
     MSAKINQLKS LALGGVLALS MAPAINAQTL HQRTFSQRPL KTQKFSCGRH LKTFVVRSLN        60
     RQRGRGIRCV KVSTVRRGSR RLPKIAWYGE GNWNGKSYRH VGHAFGNRRL MRGYASDIYG       120
     NGEHFKNNFP GNLRVRMISP SRIQVTGAWN EEWIQVRTTQ YQPLRRARTC GKFFDQYRVA       180
     DLIAPPKGRQ GRGLRCVLKV GPQGSYAPKR YFTTWFGNGQ WGQSTYSHLG TRSLKGAGAS       240
     DICGSVFGPV CNHFNYGSLK IKPVGNGFNV VGAWREMWR                              279
//

If you have problems or comments...

PBIL Back to PBIL home page