(data stored in ACNUC5340 zone)

EMBL: CP000828.PE317

CP000828.PE317       Location/Qualifiers
FT   CDS             complement(320491..320772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0349"
FT                   /product="molybdopterin converting factor, subunit 1,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25408"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9W8"
FT                   /protein_id="ABW25408.1"
FT                   /translation="MRNACLRMSAPNIKVTVKLFAAYQEVVGSPELELEFPDGSIVAHV
FT                   GQYFWEQYPELASLQSVTHFGVNLDFVSGDTPLQPGDEVVLIPPVSGG"
     MRNACLRMSA PNIKVTVKLF AAYQEVVGSP ELELEFPDGS IVAHVGQYFW EQYPELASLQ        60
     SVTHFGVNLD FVSGDTPLQP GDEVVLIPPV SGG                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page