(data stored in ACNUC27125 zone)

EMBL: CP000828.PE321

CP000828.PE321       Location/Qualifiers
FT   CDS             322219..323034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0354"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25412"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B0C3J9"
FT                   /protein_id="ABW25412.1"
FT                   /translation="MGCALLRLVSCSISVVTPLTNGNTSRRKRVICIPSQSIILAIAIK
FT                   SLTGTSFERLPTSIVIKPKLRWLNYGMERLVIEPSQEPSRKSDLLEKKTYGYRERDKHK
FT                   RAAFIKRLSTVDPDDIVYADESGMDHRDEYDYAYGPKGERVYALKTGRRSGRVNMIAAL
FT                   RAKQLMAPFTIEGACNRTVFELWLERCLIPVLKPGQKLVIDNATFHKGGQIQELVEKAG
FT                   CEVWYLPPYSPDLNKIERSWSWIKSRIRHQLEHFGSLREAMEHVLHLVS"
     MGCALLRLVS CSISVVTPLT NGNTSRRKRV ICIPSQSIIL AIAIKSLTGT SFERLPTSIV        60
     IKPKLRWLNY GMERLVIEPS QEPSRKSDLL EKKTYGYRER DKHKRAAFIK RLSTVDPDDI       120
     VYADESGMDH RDEYDYAYGP KGERVYALKT GRRSGRVNMI AALRAKQLMA PFTIEGACNR       180
     TVFELWLERC LIPVLKPGQK LVIDNATFHK GGQIQELVEK AGCEVWYLPP YSPDLNKIER       240
     SWSWIKSRIR HQLEHFGSLR EAMEHVLHLV S                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page