(data stored in ACNUC5340 zone)

EMBL: CP000828.PE322

CP000828.PE322       Location/Qualifiers
FT   CDS             complement(322994..323239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25413"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9X3"
FT                   /protein_id="ABW25413.1"
FT                   /translation="MFFDEFAVSERPRLFYGWAERNTRPQVKSNERARNKLNGLLCVDA
FT                   HSGEEYFALSPQAKTEDIAVAILFRTLDVEHVPLLL"
     MFFDEFAVSE RPRLFYGWAE RNTRPQVKSN ERARNKLNGL LCVDAHSGEE YFALSPQAKT        60
     EDIAVAILFR TLDVEHVPLL L                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page