(data stored in ACNUC27125 zone)

EMBL: CP000828.PE325

CP000828.PE325       Location/Qualifiers
FT   CDS             complement(325811..326014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0357"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25416"
FT                   /db_xref="InterPro:IPR021231"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9X6"
FT                   /protein_id="ABW25416.1"
FT                   /translation="MNATISILAEIPEELHITLKGYLESHPDWDQDRVFSAALSLFLLQ
FT                   NGEGDRRAARVYLDTLFQRSAG"
     MNATISILAE IPEELHITLK GYLESHPDWD QDRVFSAALS LFLLQNGEGD RRAARVYLDT        60
     LFQRSAG                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page