(data stored in ACNUC27125 zone)

EMBL: CP000828.PE329

CP000828.PE329       Location/Qualifiers
FT   CDS             complement(329102..329899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25420"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9Y0"
FT                   /protein_id="ABW25420.1"
FT                   /translation="MELAIPPTTPSMSLQQTFRQQGYVVIKNFFSPQEMATLIEQIESP
FT                   QSRQCLDQCLTKGTLRFYANLYRHNESIQKFVSQPKIVNFLYPFIGSDFWVRWDQAVAK
FT                   GPGAKTFPWHQDNAYNGFKQTHYQLWVALTSMTIENGGLWLVPGSHHQLLPHRKINDHM
FT                   VYQGEPESPTFITAEVGDIVLFSSLTLHKTTPNTTEGIRWAYVIEYMSTNDYDPGIAPP
FT                   FLKVAKQGQPQAEFVQSYRGRNPINRLKHRLSRREISQILEWQ"
     MELAIPPTTP SMSLQQTFRQ QGYVVIKNFF SPQEMATLIE QIESPQSRQC LDQCLTKGTL        60
     RFYANLYRHN ESIQKFVSQP KIVNFLYPFI GSDFWVRWDQ AVAKGPGAKT FPWHQDNAYN       120
     GFKQTHYQLW VALTSMTIEN GGLWLVPGSH HQLLPHRKIN DHMVYQGEPE SPTFITAEVG       180
     DIVLFSSLTL HKTTPNTTEG IRWAYVIEYM STNDYDPGIA PPFLKVAKQG QPQAEFVQSY       240
     RGRNPINRLK HRLSRREISQ ILEWQ                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page