(data stored in ACNUC8465 zone)

EMBL: CP000828.PE332

CP000828.PE332       Location/Qualifiers
FT   CDS             332200..334383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0364"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25423"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9Y3"
FT                   /protein_id="ABW25423.1"
FT                   /translation="MSISRRNFLLFMGAATTMVTCNASANRPYRSSTATEATISFKPVR
FT                   VPIPLDIEGLSPEQQKQAYSTYQVIDDLVLPEGYVYETIAAWGDPVGDSRFGYNNDFVS
FT                   FVETAPNSGYLSINFEYISGKTWMQTYEQVLGKSLPFDQVRAAMGQEKIDAFGLPADDP
FT                   LKQQIEAIAKEGLIDQGIGVIAIQSKQGKWMRQSSAQDRRITGISGLEDGHYLKATGPG
FT                   VAVFTKPKKRGYDDNLGSRIIGTFQNCAGGTTPWGTILSAEENFQDQVPEPVMADGSSF
FT                   PPSHTPFELTEDKVDGRGNPFGLAGNKYGWMVEVDPSNPKNYGIKHTWLGRYRHEAVAV
FT                   NAMEGQPLAVYSGCDRRGGHLYKFVSTGKVKNPTDKANSKLLEKGMLYGAQLNADGTGQ
FT                   WIPLKTSTPINPILPSQVLGEPDSSLVTLPNPDRQEGGYIDVTSDQDAISFQQTFKTLG
FT                   DLYEGSANERQGAILVDAHYAANAAGITCLARPEDTTFDPEQKALFVAFTSGGPGGDGG
FT                   PDQQIFQGPNGEAPYEYGWIMKIMEADDNPAAMQFRWVMVAVGGEPAQDGLGFANPDNL
FT                   EIDAQGNLWMVTDMSTSKHNLAIPNRSGVDPSKLRGIFGNNTAWYLPLMGTHAGKAFPF
FT                   AMGPMDSELCGLCLHPNQKALFLTAQHPGEAGGIRQKMASETREIAILTTDGQAFLQAR
FT                   EVPIGSNWPEKKATDPPKPALVAIYRSDGKVLI"
     MSISRRNFLL FMGAATTMVT CNASANRPYR SSTATEATIS FKPVRVPIPL DIEGLSPEQQ        60
     KQAYSTYQVI DDLVLPEGYV YETIAAWGDP VGDSRFGYNN DFVSFVETAP NSGYLSINFE       120
     YISGKTWMQT YEQVLGKSLP FDQVRAAMGQ EKIDAFGLPA DDPLKQQIEA IAKEGLIDQG       180
     IGVIAIQSKQ GKWMRQSSAQ DRRITGISGL EDGHYLKATG PGVAVFTKPK KRGYDDNLGS       240
     RIIGTFQNCA GGTTPWGTIL SAEENFQDQV PEPVMADGSS FPPSHTPFEL TEDKVDGRGN       300
     PFGLAGNKYG WMVEVDPSNP KNYGIKHTWL GRYRHEAVAV NAMEGQPLAV YSGCDRRGGH       360
     LYKFVSTGKV KNPTDKANSK LLEKGMLYGA QLNADGTGQW IPLKTSTPIN PILPSQVLGE       420
     PDSSLVTLPN PDRQEGGYID VTSDQDAISF QQTFKTLGDL YEGSANERQG AILVDAHYAA       480
     NAAGITCLAR PEDTTFDPEQ KALFVAFTSG GPGGDGGPDQ QIFQGPNGEA PYEYGWIMKI       540
     MEADDNPAAM QFRWVMVAVG GEPAQDGLGF ANPDNLEIDA QGNLWMVTDM STSKHNLAIP       600
     NRSGVDPSKL RGIFGNNTAW YLPLMGTHAG KAFPFAMGPM DSELCGLCLH PNQKALFLTA       660
     QHPGEAGGIR QKMASETREI AILTTDGQAF LQAREVPIGS NWPEKKATDP PKPALVAIYR       720
     SDGKVLI                                                                 727
//

If you have problems or comments...

PBIL Back to PBIL home page