(data stored in ACNUC27125 zone)

EMBL: CP000828.PE337

CP000828.PE337       Location/Qualifiers
FT   CDS             complement(339656..340600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25428"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9Y8"
FT                   /protein_id="ABW25428.1"
FT                   /translation="MGKLKDAGKKTLRNLFELGQNLGFDILPHHFYSEIPNINELKKSN
FT                   YWKIPYSMIEVNGIDTQEQIAFVSDCFNTQLIDFLNCNNIHSEASKINNKVGFGPIEAD
FT                   FLFAFISKHQPKQIFQIGCGVSTAVCLKAANYACYAPEIICVEPYPNNYLREIERQGRI
FT                   TLINEKAQSYCPINIEKLDSDVLFFVDSTHTLGPSGEVSRIILEMLPRLKKGAWVHFHD
FT                   IKFPYDYDRNILDSALFFQHESVLLHAFLVGNNRFKICASLSMLHYSCPTVLAQFLTKY
FT                   KPASNDEGLNSYDSLNKQEQFHFPSSTYLKVIT"
     MGKLKDAGKK TLRNLFELGQ NLGFDILPHH FYSEIPNINE LKKSNYWKIP YSMIEVNGID        60
     TQEQIAFVSD CFNTQLIDFL NCNNIHSEAS KINNKVGFGP IEADFLFAFI SKHQPKQIFQ       120
     IGCGVSTAVC LKAANYACYA PEIICVEPYP NNYLREIERQ GRITLINEKA QSYCPINIEK       180
     LDSDVLFFVD STHTLGPSGE VSRIILEMLP RLKKGAWVHF HDIKFPYDYD RNILDSALFF       240
     QHESVLLHAF LVGNNRFKIC ASLSMLHYSC PTVLAQFLTK YKPASNDEGL NSYDSLNKQE       300
     QFHFPSSTYL KVIT                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page