(data stored in ACNUC5340 zone)

EMBL: CP000828.PE346

CP000828.PE346       Location/Qualifiers
FT   CDS             complement(349790..350710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0380"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25437"
FT                   /db_xref="GOA:B0C9Z7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9Z7"
FT                   /protein_id="ABW25437.1"
FT                   /translation="MALLKKIHPKAVLLTSFNYKFDIIAYFSSIWMGLPIWVRTETQDE
FT                   AFSRHFFKTALRSLLYRFLYMPVDRGLYIGQLNKKHYLTHGLKEHQLLPAHYCTFNPIQ
FT                   QILPSDKQAIRDKIRYKLRIPKEKKIVAFFGKFIQKKDPILLYKSLSHLSSDVLNQIEF
FT                   LFVGDGTLNSQLRKLAANYSESLNVRSHFPGFINQSELHYWYLAADIVVLPSQRMGETW
FT                   GLVINEALQAGCSVIISSAVGCQADFKIFKRVRIIPVGDAKCLAKEIEVLLKFHRDFTW
FT                   ADSFLRNYSIESAAQALAESIDSIN"
     MALLKKIHPK AVLLTSFNYK FDIIAYFSSI WMGLPIWVRT ETQDEAFSRH FFKTALRSLL        60
     YRFLYMPVDR GLYIGQLNKK HYLTHGLKEH QLLPAHYCTF NPIQQILPSD KQAIRDKIRY       120
     KLRIPKEKKI VAFFGKFIQK KDPILLYKSL SHLSSDVLNQ IEFLFVGDGT LNSQLRKLAA       180
     NYSESLNVRS HFPGFINQSE LHYWYLAADI VVLPSQRMGE TWGLVINEAL QAGCSVIISS       240
     AVGCQADFKI FKRVRIIPVG DAKCLAKEIE VLLKFHRDFT WADSFLRNYS IESAAQALAE       300
     SIDSIN                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page