(data stored in ACNUC27125 zone)

EMBL: CP000828.PE347

CP000828.PE347       Location/Qualifiers
FT   CDS             complement(350730..350852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25438"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9Z8"
FT                   /protein_id="ABW25438.1"
FT                   /translation="MRGYQDSGFGVDFSWDIPLLEDYQYFVLNKASNNSPHLFF"
     MRGYQDSGFG VDFSWDIPLL EDYQYFVLNK ASNNSPHLFF                              40
//

If you have problems or comments...

PBIL Back to PBIL home page