(data stored in ACNUC27125 zone)

EMBL: CP000828.PE350

CP000828.PE350       Location/Qualifiers
FT   CDS             complement(353574..354740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0384"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25441"
FT                   /db_xref="GOA:B0CA01"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B0CA01"
FT                   /protein_id="ABW25441.1"
FT                   /translation="MSISDFSIVQTTIGRFHHFHLARQLERFNLLSAIFTGYPLSKLRD
FT                   ETGIPIEKIHSFPWVQMPYMARGRIKLDRWNWLNREWAWQAHQTLDLYVSKHVKEFTTL
FT                   IALSGSGLVSGLKAQRLGGYYICDRGSSHIRYQDEILREEHTRWNVPYKGIDPRVIDKE
FT                   EAEYESANYITVPSEFVRQSFIEQRVSPDKVRKISYGARLDRFHPISKPKPDEFRILFV
FT                   GSVSFRKGFLDLLQAFNDFKHPNKKLVVIGSVSSNIIPFIEKYSIDQVTFIGKIPNKEL
FT                   PRYYSESHVFVLPSIEEGLAMVMGEALACGCPVIATENAGVSDLLQDGREGFIVPIRQP
FT                   QAITDKLQLLSDCPDLREKLSKNALKRVKQLGGWDCYGDQWFKFLQTF"
     MSISDFSIVQ TTIGRFHHFH LARQLERFNL LSAIFTGYPL SKLRDETGIP IEKIHSFPWV        60
     QMPYMARGRI KLDRWNWLNR EWAWQAHQTL DLYVSKHVKE FTTLIALSGS GLVSGLKAQR       120
     LGGYYICDRG SSHIRYQDEI LREEHTRWNV PYKGIDPRVI DKEEAEYESA NYITVPSEFV       180
     RQSFIEQRVS PDKVRKISYG ARLDRFHPIS KPKPDEFRIL FVGSVSFRKG FLDLLQAFND       240
     FKHPNKKLVV IGSVSSNIIP FIEKYSIDQV TFIGKIPNKE LPRYYSESHV FVLPSIEEGL       300
     AMVMGEALAC GCPVIATENA GVSDLLQDGR EGFIVPIRQP QAITDKLQLL SDCPDLREKL       360
     SKNALKRVKQ LGGWDCYGDQ WFKFLQTF                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page