(data stored in ACNUC27125 zone)

EMBL: CP000828.PE351

CP000828.PE351       Location/Qualifiers
FT   CDS             complement(354781..355623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25442"
FT                   /db_xref="GOA:B0CA02"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="UniProtKB/TrEMBL:B0CA02"
FT                   /protein_id="ABW25442.1"
FT                   /translation="MAISEELNLVFIHIPKNAGKSVTSALNIFDLSNKRNNKLVQRNLI
FT                   GNVGRFFSQRSNRHSLNFSPKMGMYDYPLYMGHCTLQEMVSLRLSSIEFFKNADKFAVI
FT                   RNPFSRTLSLFHHWCKKNYRDKSEASILFDKFITEIENIRSYGEIGSDTLLGKCRHSMI
FT                   SHFNLQVEFLDTNFSGISSDYILQYEYLNDALKSFIQYITLPVDQFAWETYPNSLSKDS
FT                   FWYEILNSNEIVLKINRIFSRDFYELGYQTDNFSFENSKSCFPKGYEEISSGFFKRVS"
     MAISEELNLV FIHIPKNAGK SVTSALNIFD LSNKRNNKLV QRNLIGNVGR FFSQRSNRHS        60
     LNFSPKMGMY DYPLYMGHCT LQEMVSLRLS SIEFFKNADK FAVIRNPFSR TLSLFHHWCK       120
     KNYRDKSEAS ILFDKFITEI ENIRSYGEIG SDTLLGKCRH SMISHFNLQV EFLDTNFSGI       180
     SSDYILQYEY LNDALKSFIQ YITLPVDQFA WETYPNSLSK DSFWYEILNS NEIVLKINRI       240
     FSRDFYELGY QTDNFSFENS KSCFPKGYEE ISSGFFKRVS                             280
//

If you have problems or comments...

PBIL Back to PBIL home page