(data stored in ACNUC27125 zone)

EMBL: CP000828.PE352

CP000828.PE352       Location/Qualifiers
FT   CDS             complement(355745..357541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0386"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25443"
FT                   /db_xref="GOA:B0CA03"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B0CA03"
FT                   /protein_id="ABW25443.1"
FT                   /translation="MNFSAFSLLPYLSKNRRLELLFFLALSILSSFLEIGSLGSLYPFL
FT                   QAVLNPKKIIESLPIGFSGLSRMHENNIILGMGIIFLVIVVFSTVVRIYTIWVQQKLTA
FT                   NIAADLSISSFDNLLKRPYIWHITHNSSEVITRLTEDVNQVRTVILSGLNIILSSLIVL
FT                   SLGLTLVLISPHITLFATFILGSSYIIIYRLTRGTFYREGKERIESHQRSIKTLQESLG
FT                   GIRDILLDDSQSVFLNDYSQSVNISRQAVARINFKAQIPRYLIEGITILLISGLVFILV
FT                   LQGKNISNIIPVLGSFTLGAYKILQPLQNVFVALASIKSNSSSIERLLPYLEGTQHREN
FT                   LDSLISTKSEDLILEKNIELRDVWFRYQSAGDWVIKDLNLRIPIGSRVGFVGPTGSGKS
FT                   TIVDLIMGLLKPSKGGLILDGYNASEDIDLMKAWRHYIAHVPQYIYLSDASFAENIAFG
FT                   VPMQEIDLLRVKESAQKAQVSNFIEDQALGYFETIGERGIGLSGGQRQRIGIARALYKG
FT                   ARVLLLDEATSALDNKTEREFISTLLSGNDNLTIIMIAHRLSTVEKCDLIYEFSFGKLV
FT                   DNGTYNSLLENSHTFRSLAKTN"
     MNFSAFSLLP YLSKNRRLEL LFFLALSILS SFLEIGSLGS LYPFLQAVLN PKKIIESLPI        60
     GFSGLSRMHE NNIILGMGII FLVIVVFSTV VRIYTIWVQQ KLTANIAADL SISSFDNLLK       120
     RPYIWHITHN SSEVITRLTE DVNQVRTVIL SGLNIILSSL IVLSLGLTLV LISPHITLFA       180
     TFILGSSYII IYRLTRGTFY REGKERIESH QRSIKTLQES LGGIRDILLD DSQSVFLNDY       240
     SQSVNISRQA VARINFKAQI PRYLIEGITI LLISGLVFIL VLQGKNISNI IPVLGSFTLG       300
     AYKILQPLQN VFVALASIKS NSSSIERLLP YLEGTQHREN LDSLISTKSE DLILEKNIEL       360
     RDVWFRYQSA GDWVIKDLNL RIPIGSRVGF VGPTGSGKST IVDLIMGLLK PSKGGLILDG       420
     YNASEDIDLM KAWRHYIAHV PQYIYLSDAS FAENIAFGVP MQEIDLLRVK ESAQKAQVSN       480
     FIEDQALGYF ETIGERGIGL SGGQRQRIGI ARALYKGARV LLLDEATSAL DNKTEREFIS       540
     TLLSGNDNLT IIMIAHRLST VEKCDLIYEF SFGKLVDNGT YNSLLENSHT FRSLAKTN         598
//

If you have problems or comments...

PBIL Back to PBIL home page