(data stored in ACNUC8465 zone)

EMBL: CP000828.PE353

CP000828.PE353       Location/Qualifiers
FT   CDS             complement(357699..358985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0387"
FT                   /product="glycosyl transferase, group 1 family protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25444"
FT                   /db_xref="GOA:B0CA04"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B0CA04"
FT                   /protein_id="ABW25444.1"
FT                   /translation="MIYSLNYFPELIGIGKYNTEMANWLVNEGYDVDVVCAPPYYPSWE
FT                   LSPGFSGWRYSCNHYGLVSVHRCPVWLPKKLSGINRILHLFSFAISSAIQFIWLIFKKK
FT                   ISGVESIIFLVEPPIFCLPAVLIASKIFQFKVWLHVQDFEIDAGFSLGLLPSFPRLTVL
FT                   VGSIENWLMQKVQVVSTISAQMSLRLYQKGVKLDKCVYFPNWVDCNAIHPINETNEYRA
FT                   QLGISEDKIVCLYSGNLGAKQGISILIEAARILECTEKIVFVIAGQGPMKRVLVEQARC
FT                   LSNIYFLDLQPSERFNALLNMADIHLLPQASGVGDLVLPSKLKAMLASGRPVIATAYPG
FT                   TQVFNIVQTCGVAVPPEEVQELTKAIADLANHHQKRQKLGSEGRKYALSHWDREQVLSQ
FT                   FESKLRKLIFTGKLVNQDLDSEAQKTITA"
     MIYSLNYFPE LIGIGKYNTE MANWLVNEGY DVDVVCAPPY YPSWELSPGF SGWRYSCNHY        60
     GLVSVHRCPV WLPKKLSGIN RILHLFSFAI SSAIQFIWLI FKKKISGVES IIFLVEPPIF       120
     CLPAVLIASK IFQFKVWLHV QDFEIDAGFS LGLLPSFPRL TVLVGSIENW LMQKVQVVST       180
     ISAQMSLRLY QKGVKLDKCV YFPNWVDCNA IHPINETNEY RAQLGISEDK IVCLYSGNLG       240
     AKQGISILIE AARILECTEK IVFVIAGQGP MKRVLVEQAR CLSNIYFLDL QPSERFNALL       300
     NMADIHLLPQ ASGVGDLVLP SKLKAMLASG RPVIATAYPG TQVFNIVQTC GVAVPPEEVQ       360
     ELTKAIADLA NHHQKRQKLG SEGRKYALSH WDREQVLSQF ESKLRKLIFT GKLVNQDLDS       420
     EAQKTITA                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page