(data stored in ACNUC8465 zone)

EMBL: CP000828.PE354

CP000828.PE354       Location/Qualifiers
FT   CDS             complement(359547..360719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25445"
FT                   /db_xref="InterPro:IPR039498"
FT                   /db_xref="UniProtKB/TrEMBL:B0CA05"
FT                   /protein_id="ABW25445.1"
FT                   /translation="MIYIKLKKRSSTEFSNEQKLLLSCLQLKSQTRYFKINAILDHHSI
FT                   DWHHFLRLTKFHKVIPPVYQCLKQHTHKNIPDYLLASLRKYSCEITLKNTLHVEELKQL
FT                   LNLFETHDIDVIPFKGPTLAQIAYGGTHARQFCDLDFLVSRKDFKRCVNLLISLNYRSP
FT                   YVNQGWNYSILYKIIKNFHYDFIAHEISFGKRKQDCNVFIDLHQNISKYCPESFEIFSD
FT                   RLLKIKLQQQYYQSLKTEDLLNVLCIHNSQDGWKKFQAIYDVANLVDNNPTLNWPDVLK
FT                   LSQELRCRRRLLLGLALCKSYFDIDLSDSIENMILTDQIISDLIGQIDLSLKNSPVSRR
FT                   TFSMKIRFQFMKMQMLESFYYKQKVLFDFVWYYLFDNFYRAKVMTMPFSK"
     MIYIKLKKRS STEFSNEQKL LLSCLQLKSQ TRYFKINAIL DHHSIDWHHF LRLTKFHKVI        60
     PPVYQCLKQH THKNIPDYLL ASLRKYSCEI TLKNTLHVEE LKQLLNLFET HDIDVIPFKG       120
     PTLAQIAYGG THARQFCDLD FLVSRKDFKR CVNLLISLNY RSPYVNQGWN YSILYKIIKN       180
     FHYDFIAHEI SFGKRKQDCN VFIDLHQNIS KYCPESFEIF SDRLLKIKLQ QQYYQSLKTE       240
     DLLNVLCIHN SQDGWKKFQA IYDVANLVDN NPTLNWPDVL KLSQELRCRR RLLLGLALCK       300
     SYFDIDLSDS IENMILTDQI ISDLIGQIDL SLKNSPVSRR TFSMKIRFQF MKMQMLESFY       360
     YKQKVLFDFV WYYLFDNFYR AKVMTMPFSK                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page