(data stored in ACNUC8465 zone)

EMBL: CP000828.PE356

CP000828.PE356       Location/Qualifiers
FT   CDS             complement(361736..361900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25447"
FT                   /db_xref="UniProtKB/TrEMBL:B0CA07"
FT                   /protein_id="ABW25447.1"
FT                   /translation="MKRKFSTPKLTAFGSLVGITQEFDDEAREFEEQFEEVDDDFESAA
FT                   VIAPELDDG"
     MKRKFSTPKL TAFGSLVGIT QEFDDEAREF EEQFEEVDDD FESAAVIAPE LDDG              54
//

If you have problems or comments...

PBIL Back to PBIL home page