(data stored in ACNUC27125 zone)

EMBL: CP000828.PE359

CP000828.PE359       Location/Qualifiers
FT   CDS             366086..367057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0393"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25450"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAW0"
FT                   /protein_id="ABW25450.1"
FT                   /translation="MRVLVTGAAGFIGYHLSQRLLLDRAQVFGIDNLNNYYAVDLKKSR
FT                   LAQLEPNQNFQFQCLDLSDRNGMETLFESNTFDGVIHLAAQAGVRYSLDNPHAYVDSNL
FT                   VGFLHILEGCRQSNISHLVYASSSSVYGANKKVPFSVEDNVDHPVSLYAATKKSNELMA
FT                   HSYSHLYQIPITGLRFFTVYGPWGRPDMAYFKFVDAIANNKSIDVYNHGKMQRDFTYID
FT                   DVVEGIVRVLHQPPNPDTTTPPYKLYNIGNNQPVTLMRFIEVIETAMGKTADKNFLPMQ
FT                   PGDVPATYADVDALMNDVGFQPKTPIEDGIQKFVTWYRSYYQ"
     MRVLVTGAAG FIGYHLSQRL LLDRAQVFGI DNLNNYYAVD LKKSRLAQLE PNQNFQFQCL        60
     DLSDRNGMET LFESNTFDGV IHLAAQAGVR YSLDNPHAYV DSNLVGFLHI LEGCRQSNIS       120
     HLVYASSSSV YGANKKVPFS VEDNVDHPVS LYAATKKSNE LMAHSYSHLY QIPITGLRFF       180
     TVYGPWGRPD MAYFKFVDAI ANNKSIDVYN HGKMQRDFTY IDDVVEGIVR VLHQPPNPDT       240
     TTPPYKLYNI GNNQPVTLMR FIEVIETAMG KTADKNFLPM QPGDVPATYA DVDALMNDVG       300
     FQPKTPIEDG IQKFVTWYRS YYQ                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page