(data stored in ACNUC5340 zone)

EMBL: CP000828.PE36

CP000828.PE36        Location/Qualifiers
FT   CDS             complement(40992..41120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25127"
FT                   /db_xref="UniProtKB/TrEMBL:B0C515"
FT                   /protein_id="ABW25127.1"
FT                   /translation="MDLNLAALSAREAYYASPMSIEVSRWIGGYLQGKFISEKYGL"
     MDLNLAALSA REAYYASPMS IEVSRWIGGY LQGKFISEKY GL                           42
//

If you have problems or comments...

PBIL Back to PBIL home page