(data stored in ACNUC27125 zone)

EMBL: CP000828.PE363

CP000828.PE363       Location/Qualifiers
FT   CDS             complement(370596..370898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25454"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAW4"
FT                   /protein_id="ABW25454.1"
FT                   /translation="MGERAQAYSQITNPEEHAKAIVEITSCLKSFRDRYAEFLSSEDLQ
FT                   RLKVYLQAMQEIIDSNEKVKATISALDDLFASWHERFDEQEMYESSALVAEIFGS"
     MGERAQAYSQ ITNPEEHAKA IVEITSCLKS FRDRYAEFLS SEDLQRLKVY LQAMQEIIDS        60
     NEKVKATISA LDDLFASWHE RFDEQEMYES SALVAEIFGS                             100
//

If you have problems or comments...

PBIL Back to PBIL home page