(data stored in ACNUC27125 zone)

EMBL: CP000828.PE365

CP000828.PE365       Location/Qualifiers
FT   CDS             371844..373025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0399"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25456"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAW6"
FT                   /protein_id="ABW25456.1"
FT                   /translation="MVTQPQPRYSVQWFEQIGQISQQAWDDLAVPLKTPFLEWHWLNNL
FT                   ETSGSAIARTGWLPQHLTVWQDQTLVAAAPLYVKGHSYGEFVFDHQWADVAYRMGIEYY
FT                   PKLLGMTPFTPAEGYRFLIAPDEDEDMLTGLMVQVIDGFCAQNNLSGCHFLFVDPDWQP
FT                   VIERNGFKAWLHHSYIWQNENFSTFDDYLGAFNANQRRNIKRERKSVAKAGLELRTYQG
FT                   EEIPDFLYGRMHHYYQDTCDKFMWGSKYLTRRFFLDLQSTYADRVIFVAAYPEGDIQQP
FT                   VGMSFCLTKGEQLYGRYWGSDREFDCLHFEACYYSPIEWAVAQGIQRFDPGAGGRHKKR
FT                   RGFRATPNYSLHRFYEPRLQQIFHHYIDEINEDEQREIDYINQELPFKQKTGS"
     MVTQPQPRYS VQWFEQIGQI SQQAWDDLAV PLKTPFLEWH WLNNLETSGS AIARTGWLPQ        60
     HLTVWQDQTL VAAAPLYVKG HSYGEFVFDH QWADVAYRMG IEYYPKLLGM TPFTPAEGYR       120
     FLIAPDEDED MLTGLMVQVI DGFCAQNNLS GCHFLFVDPD WQPVIERNGF KAWLHHSYIW       180
     QNENFSTFDD YLGAFNANQR RNIKRERKSV AKAGLELRTY QGEEIPDFLY GRMHHYYQDT       240
     CDKFMWGSKY LTRRFFLDLQ STYADRVIFV AAYPEGDIQQ PVGMSFCLTK GEQLYGRYWG       300
     SDREFDCLHF EACYYSPIEW AVAQGIQRFD PGAGGRHKKR RGFRATPNYS LHRFYEPRLQ       360
     QIFHHYIDEI NEDEQREIDY INQELPFKQK TGS                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page