(data stored in ACNUC27125 zone)

EMBL: CP000828.PE366

CP000828.PE366       Location/Qualifiers
FT   CDS             373301..373444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25457"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAW7"
FT                   /protein_id="ABW25457.1"
FT                   /translation="MVNGQKELQEKLGRKDPCPCGSGRKFKHCCMQSGRFDGSLRDYYF
FT                   RE"
     MVNGQKELQE KLGRKDPCPC GSGRKFKHCC MQSGRFDGSL RDYYFRE                      47
//

If you have problems or comments...

PBIL Back to PBIL home page