(data stored in ACNUC8465 zone)

EMBL: CP000828.PE379

CP000828.PE379       Location/Qualifiers
FT   CDS             387409..388323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0413"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25470"
FT                   /db_xref="GOA:B0CAY0"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAY0"
FT                   /protein_id="ABW25470.1"
FT                   /translation="MDGVKEWLINHDWVQTFRSLIDISLALALTYMLLLVIAERRTLWM
FT                   VRGVVFLVLATVASKLLQFNYLNQLLTFLLIGSAVAMAVILQSEVRRFLEQLGRGELLK
FT                   MLRPAQQVTQNPDNIIDEIVDAIKELSQNRTGALLIIETRNIPIDERDFSVPGIKLSAE
FT                   ISRELIQTIFQTTTLLHDGAILIRGDRIVSAGVILPISEQTASRQLGTRHRAAMGITER
FT                   VDNCVCIVVSEETGSISLAEQGILRRPLTSSKLRELLADRLILSVDREVVTPSLRSLGR
FT                   KIRKQIFSLLSLIFPLLKSRKNI"
     MDGVKEWLIN HDWVQTFRSL IDISLALALT YMLLLVIAER RTLWMVRGVV FLVLATVASK        60
     LLQFNYLNQL LTFLLIGSAV AMAVILQSEV RRFLEQLGRG ELLKMLRPAQ QVTQNPDNII       120
     DEIVDAIKEL SQNRTGALLI IETRNIPIDE RDFSVPGIKL SAEISRELIQ TIFQTTTLLH       180
     DGAILIRGDR IVSAGVILPI SEQTASRQLG TRHRAAMGIT ERVDNCVCIV VSEETGSISL       240
     AEQGILRRPL TSSKLRELLA DRLILSVDRE VVTPSLRSLG RKIRKQIFSL LSLIFPLLKS       300
     RKNI                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page