(data stored in ACNUC5340 zone)

EMBL: CP000828.PE381

CP000828.PE381       Location/Qualifiers
FT   CDS             complement(389243..389524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0415"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25472"
FT                   /db_xref="InterPro:IPR021489"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAY2"
FT                   /protein_id="ABW25472.1"
FT                   /translation="MTESCLPDPKTPLYNHPLPQIELWLHQLGCHQDSQDLHLWRVERD
FT                   QWKAEIWLDIEELSVVYVPAVSTERDIQRTFKYSLSRQDIEDAVFSGP"
     MTESCLPDPK TPLYNHPLPQ IELWLHQLGC HQDSQDLHLW RVERDQWKAE IWLDIEELSV        60
     VYVPAVSTER DIQRTFKYSL SRQDIEDAVF SGP                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page