(data stored in ACNUC5340 zone)

EMBL: CP000828.PE382

CP000828.PE382       Location/Qualifiers
FT   CDS             complement(389862..390305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0416"
FT                   /product="DnaJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25473"
FT                   /db_xref="GOA:B0CAY3"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAY3"
FT                   /protein_id="ABW25473.1"
FT                   /translation="MSMDSNFYQLLDLSPGASSDEIHDAYRRKSKVYHPDTTALPKETA
FT                   IQKFQQLNDAYRVLSSPELRKSYDYRLGVSPAKYTSVQKVRSSDNPLASSQVQIQERPL
FT                   SSGELVALLILCITFLGCLILAVVLGFARGEMMFVGLATLYLI"
     MSMDSNFYQL LDLSPGASSD EIHDAYRRKS KVYHPDTTAL PKETAIQKFQ QLNDAYRVLS        60
     SPELRKSYDY RLGVSPAKYT SVQKVRSSDN PLASSQVQIQ ERPLSSGELV ALLILCITFL       120
     GCLILAVVLG FARGEMMFVG LATLYLI                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page