(data stored in ACNUC27125 zone)

EMBL: CP000828.PE39

CP000828.PE39        Location/Qualifiers
FT   CDS             43917..44111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25130"
FT                   /db_xref="UniProtKB/TrEMBL:B0C518"
FT                   /protein_id="ABW25130.1"
FT                   /translation="MRIRLIKYYQLVETIFNSDQEIHFNLSESLRSESGKGTDRFPRTA
FT                   KTRYSPNPEEKQEIWPILF"
     MRIRLIKYYQ LVETIFNSDQ EIHFNLSESL RSESGKGTDR FPRTAKTRYS PNPEEKQEIW        60
     PILF                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page