(data stored in ACNUC5340 zone)

EMBL: CP000828.PE390

CP000828.PE390       Location/Qualifiers
FT   CDS             399730..399966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25481"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAZ1"
FT                   /protein_id="ABW25481.1"
FT                   /translation="MPASDDQIDLRGTPCPLNFVRTKLHLQKMAPGSLLEVWLDPGEPI
FT                   EQVPDSLKMAGYTIEQLKDCSGFYALQVRSADL"
     MPASDDQIDL RGTPCPLNFV RTKLHLQKMA PGSLLEVWLD PGEPIEQVPD SLKMAGYTIE        60
     QLKDCSGFYA LQVRSADL                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page