(data stored in ACNUC27125 zone)

EMBL: CP000828.PE394

CP000828.PE394       Location/Qualifiers
FT   CDS             402662..403381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0428"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25485"
FT                   /db_xref="GOA:B0CAZ5"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAZ5"
FT                   /protein_id="ABW25485.1"
FT                   /translation="MKVQLNKLWDWKGQLQRWLIVGLLTLLVGLPLWSPPALATVVEDI
FT                   PNLSASQSTWLADKAELLSVVTERSVNKTLKQISRQTGTDVRVITIRGLNYGETADSFA
FT                   NTLFEQWFPTAEDQANQVLLVYDARTNAPAILVGQEAQKLLSEETAQSIAFDNLLIPIR
FT                   KGNYNEAFIGAGDRFAAVISGQEDPGPPEVEVTAFAESNFRTAEETNDTSSAILVVVLL
FT                   ILATAIPMLTYFYYQRS"
     MKVQLNKLWD WKGQLQRWLI VGLLTLLVGL PLWSPPALAT VVEDIPNLSA SQSTWLADKA        60
     ELLSVVTERS VNKTLKQISR QTGTDVRVIT IRGLNYGETA DSFANTLFEQ WFPTAEDQAN       120
     QVLLVYDART NAPAILVGQE AQKLLSEETA QSIAFDNLLI PIRKGNYNEA FIGAGDRFAA       180
     VISGQEDPGP PEVEVTAFAE SNFRTAEETN DTSSAILVVV LLILATAIPM LTYFYYQRS        239
//

If you have problems or comments...

PBIL Back to PBIL home page