(data stored in ACNUC8465 zone)

EMBL: CP000828.PE398

CP000828.PE398       Location/Qualifiers
FT   CDS             complement(406765..407124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0432"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25489"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAZ9"
FT                   /protein_id="ABW25489.1"
FT                   /translation="MNDLPDFVKKAFYLGVGVASYAGEQAGNKVAEIQERAQQLADEMI
FT                   RRGEMSTDEANRWLNQFNDTPAQVSVEEVPYPDQPQTIELVTGDEAEERDPSESEDIHA
FT                   QVNELEEELRRLQDS"
     MNDLPDFVKK AFYLGVGVAS YAGEQAGNKV AEIQERAQQL ADEMIRRGEM STDEANRWLN        60
     QFNDTPAQVS VEEVPYPDQP QTIELVTGDE AEERDPSESE DIHAQVNELE EELRRLQDS        119
//

If you have problems or comments...

PBIL Back to PBIL home page