(data stored in ACNUC27125 zone)

EMBL: CP000828.PE4

CP000828.PE4         Location/Qualifiers
FT   CDS             4171..6042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25095"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B0C3W5"
FT                   /protein_id="ABW25095.1"
FT                   /translation="MDVYINQKRVRLRPQQAIGKGGEADVYRLNRTTAVKLFKPPSHPD
FT                   FEGMVEAQQGARERLALHQQKLRQFPQSLPERVISPQALVMNQNGQRILGYTMPLLTHA
FT                   EVLLRYCDRRRRVKDHCRRQVGDHRKFQQAVDTQAVVDLFLDLHETVSKLHFADVVIGD
FT                   FNDLNILVQGTQAFVIDADSFQFGSFPCSVFTARFVDPLLCDPQGTQPILCRPYCWESD
FT                   WYAFTVMLMQALLFVDPYGGVYKPSDPAQRLPQAARPLHRVTVFHPQVRYPKPALPCDH
FT                   LPKPLLDHFRQVFEQDWRGEFPRSLLENLRWHTCPSCGVEHARSACPSCVKSVGIPMPP
FT                   GAVQVTTVLQTNGVILAATLTAGQLQWLVWEEGQFKREDGTVVLTGDLSPEFDWHLQGQ
FT                   TTWIVQQGQVVELPTTERIAVDSYQGRPQFAVNDRHSYWFNQGQLMRDHAVMGEVLIGQ
FT                   TQFWVGPRFGLGFYRAGQLNGAFVFDADRSGINDRLSLSMEAGTVVAAHCTFSQSFGWL
FT                   FVTLQAQGVLQQRCWVIAPTGQVLAQAEVGEWAATASGPCPHWAVEEALFVATDEGIIR
FT                   AQVEQGQVIVQRRFPETEPFVQTGCQLLAAPQGLYTVGSQTIQLLQL"
     MDVYINQKRV RLRPQQAIGK GGEADVYRLN RTTAVKLFKP PSHPDFEGMV EAQQGARERL        60
     ALHQQKLRQF PQSLPERVIS PQALVMNQNG QRILGYTMPL LTHAEVLLRY CDRRRRVKDH       120
     CRRQVGDHRK FQQAVDTQAV VDLFLDLHET VSKLHFADVV IGDFNDLNIL VQGTQAFVID       180
     ADSFQFGSFP CSVFTARFVD PLLCDPQGTQ PILCRPYCWE SDWYAFTVML MQALLFVDPY       240
     GGVYKPSDPA QRLPQAARPL HRVTVFHPQV RYPKPALPCD HLPKPLLDHF RQVFEQDWRG       300
     EFPRSLLENL RWHTCPSCGV EHARSACPSC VKSVGIPMPP GAVQVTTVLQ TNGVILAATL       360
     TAGQLQWLVW EEGQFKREDG TVVLTGDLSP EFDWHLQGQT TWIVQQGQVV ELPTTERIAV       420
     DSYQGRPQFA VNDRHSYWFN QGQLMRDHAV MGEVLIGQTQ FWVGPRFGLG FYRAGQLNGA       480
     FVFDADRSGI NDRLSLSMEA GTVVAAHCTF SQSFGWLFVT LQAQGVLQQR CWVIAPTGQV       540
     LAQAEVGEWA ATASGPCPHW AVEEALFVAT DEGIIRAQVE QGQVIVQRRF PETEPFVQTG       600
     CQLLAAPQGL YTVGSQTIQL LQL                                               623
//

If you have problems or comments...

PBIL Back to PBIL home page