(data stored in ACNUC8465 zone)

EMBL: CP000828.PE401

CP000828.PE401       Location/Qualifiers
FT   CDS             409859..410005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25492"
FT                   /db_xref="UniProtKB/TrEMBL:B0CB02"
FT                   /protein_id="ABW25492.1"
FT                   /translation="MVPENNSKFVDQVNYTLVRFMEGYLKSKEPYVTTFRSLVWATGQS
FT                   ASF"
     MVPENNSKFV DQVNYTLVRF MEGYLKSKEP YVTTFRSLVW ATGQSASF                     48
//

If you have problems or comments...

PBIL Back to PBIL home page