(data stored in ACNUC27125 zone)

EMBL: CP000828.PE409

CP000828.PE409       Location/Qualifiers
FT   CDS             424534..426492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0444"
FT                   /product="pyruvate kinase barrel domain protein"
FT                   /note="contains a pyruvate kinase, barrel domain (PF00224),
FT                   but does not have a alpha/beta domain (PF02887)"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25500"
FT                   /db_xref="GOA:B0CB10"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B0CB10"
FT                   /protein_id="ABW25500.1"
FT                   /translation="MPRNGCATRSSNVSPMPMSMVRIKMRLSTGPGPMLESVNNIDAPR
FT                   IESAIRALEQLKARALALEQDFEIALQRTAPSHRNSARNLLHYLALRRHDIRELQLELS
FT                   HLGLSSLGLTELHVMASLNAVLIALHRLVERAVPPQLQAPTPVTFANGQALLVEHTLTA
FT                   LGPKPEQRATRIMVTMPTTAAEDPALIRRFLAAGMDIMRINCAHDGPDAWLQMIQHLRQ
FT                   AEAELGLSCKVSFDLAGPKLRTEALAPDVEVIKWQPHRDRLGHIVQPARLWLTSTSSQT
FT                   ADLDCTTIPIQSPISVQMGDMIQLTDARHRRRRLSVVEVRDNGCLCECDRTGYITSGLP
FT                   FEIQRHQAVVGTGKIGQLPALENNLTLQPGDVLRILRGDILGQPAILDATGQVLQPAHV
FT                   GCTLPQVFQDVKPGERIFFDDGKIEGLIQKVSETELRVEIVSAVKGIAKLKGEKGINLP
FT                   DTQLNLPALTPKDISDLSFVAQQGDLVALSFVQSPEDVEHLVQKLDQLGATDLGIILKI
FT                   ETRLGFENLPKLLLAAMQHRSVAVMIARGDLGVEVGFERMSEVQEQILLLCQAAHVPVI
FT                   WATQVLESLAKGGLPSRAEVTDAAMGSRAECVMLNKGPYIERAMEFLNNILQRMQENVA
FT                   KNMATLRKLRVSEIEAE"
     MPRNGCATRS SNVSPMPMSM VRIKMRLSTG PGPMLESVNN IDAPRIESAI RALEQLKARA        60
     LALEQDFEIA LQRTAPSHRN SARNLLHYLA LRRHDIRELQ LELSHLGLSS LGLTELHVMA       120
     SLNAVLIALH RLVERAVPPQ LQAPTPVTFA NGQALLVEHT LTALGPKPEQ RATRIMVTMP       180
     TTAAEDPALI RRFLAAGMDI MRINCAHDGP DAWLQMIQHL RQAEAELGLS CKVSFDLAGP       240
     KLRTEALAPD VEVIKWQPHR DRLGHIVQPA RLWLTSTSSQ TADLDCTTIP IQSPISVQMG       300
     DMIQLTDARH RRRRLSVVEV RDNGCLCECD RTGYITSGLP FEIQRHQAVV GTGKIGQLPA       360
     LENNLTLQPG DVLRILRGDI LGQPAILDAT GQVLQPAHVG CTLPQVFQDV KPGERIFFDD       420
     GKIEGLIQKV SETELRVEIV SAVKGIAKLK GEKGINLPDT QLNLPALTPK DISDLSFVAQ       480
     QGDLVALSFV QSPEDVEHLV QKLDQLGATD LGIILKIETR LGFENLPKLL LAAMQHRSVA       540
     VMIARGDLGV EVGFERMSEV QEQILLLCQA AHVPVIWATQ VLESLAKGGL PSRAEVTDAA       600
     MGSRAECVML NKGPYIERAM EFLNNILQRM QENVAKNMAT LRKLRVSEIE AE               652
//

If you have problems or comments...

PBIL Back to PBIL home page