(data stored in ACNUC5340 zone)

EMBL: CP000828.PE411

CP000828.PE411       Location/Qualifiers
FT   CDS             complement(427765..427890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25502"
FT                   /db_xref="UniProtKB/TrEMBL:B0CB12"
FT                   /protein_id="ABW25502.1"
FT                   /translation="MPRSFDLDWVQDSASLPRGWYCSCDAQRAAFRHRNPSHLAL"
     MPRSFDLDWV QDSASLPRGW YCSCDAQRAA FRHRNPSHLA L                            41
//

If you have problems or comments...

PBIL Back to PBIL home page