(data stored in ACNUC27125 zone)

EMBL: CP000828.PE412

CP000828.PE412       Location/Qualifiers
FT   CDS             complement(427897..428370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0447"
FT                   /product="pentapeptide repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25503"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:B0CB13"
FT                   /protein_id="ABW25503.1"
FT                   /translation="MRLLVYDQSRDHFALNSIHLDRGEAMMTVMNRDDFVAQYASGKRD
FT                   FAGANLRGIALSEMDLSAVNFQDVYLAGADLESVDLGEANLQGSNLRGADLGGAFLQSA
FT                   NLKGADLRGANLMGADLREAELSDARLAAADYDRNTHFPTGFHPETAKMHLVS"
     MRLLVYDQSR DHFALNSIHL DRGEAMMTVM NRDDFVAQYA SGKRDFAGAN LRGIALSEMD        60
     LSAVNFQDVY LAGADLESVD LGEANLQGSN LRGADLGGAF LQSANLKGAD LRGANLMGAD       120
     LREAELSDAR LAAADYDRNT HFPTGFHPET AKMHLVS                                157
//

If you have problems or comments...

PBIL Back to PBIL home page