(data stored in ACNUC27125 zone)

EMBL: CP000828.PE416

CP000828.PE416       Location/Qualifiers
FT   CDS             complement(431323..431535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0451"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25507"
FT                   /db_xref="GOA:B0CB17"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:B0CB17"
FT                   /protein_id="ABW25507.1"
FT                   /translation="MTKNLGLMDRLFRIGLGGLLLYLGLGTYSGSTLGMGLAIAAAIPT
FT                   FTALLGFCPIYRLLGIHTNARQLSQ"
     MTKNLGLMDR LFRIGLGGLL LYLGLGTYSG STLGMGLAIA AAIPTFTALL GFCPIYRLLG        60
     IHTNARQLSQ                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page