(data stored in ACNUC8465 zone)

EMBL: CP000828.PE420

CP000828.PE420       Location/Qualifiers
FT   CDS             435182..435634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25511"
FT                   /db_xref="UniProtKB/TrEMBL:B0CB21"
FT                   /protein_id="ABW25511.1"
FT                   /translation="MKWIHLFISIALLTSTIFMAPAYAQNTSSDSASVNTVSIRRPRHF
FT                   NPAIVETLSGKIVRVDRVASPGRRSGKGVHLSLQTSEETVDVHLGPSWYLDEQQLNLKS
FT                   GDPVEVTGSRVTDASPPAIIATQVKSGDTVLNLRDESGQPTWRGME"
     MKWIHLFISI ALLTSTIFMA PAYAQNTSSD SASVNTVSIR RPRHFNPAIV ETLSGKIVRV        60
     DRVASPGRRS GKGVHLSLQT SEETVDVHLG PSWYLDEQQL NLKSGDPVEV TGSRVTDASP       120
     PAIIATQVKS GDTVLNLRDE SGQPTWRGME                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page