(data stored in ACNUC27125 zone)

EMBL: CP000828.PE421

CP000828.PE421       Location/Qualifiers
FT   CDS             435682..436089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25512"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:B0CB22"
FT                   /protein_id="ABW25512.1"
FT                   /translation="MSDLFSPTWMQAYLNQWNAEPELASALATIHFNSTIAYGFKDVAM
FT                   PKGVLTSENGRAIKAKPYIDQPLNWDLRATPEDWQKWQSNGLSMMGLSMAYMSGKLKFE
FT                   VGDYTSIIKDPRMVGPFLMSFSVMGRVLSHA"
     MSDLFSPTWM QAYLNQWNAE PELASALATI HFNSTIAYGF KDVAMPKGVL TSENGRAIKA        60
     KPYIDQPLNW DLRATPEDWQ KWQSNGLSMM GLSMAYMSGK LKFEVGDYTS IIKDPRMVGP       120
     FLMSFSVMGR VLSHA                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page