(data stored in ACNUC5340 zone)

EMBL: CP000828.PE434

CP000828.PE434       Location/Qualifiers
FT   CDS             447139..449445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0469"
FT                   /product="two-component hybrid histidine kinase sensor and
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25525"
FT                   /db_xref="GOA:B0CBY3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0CBY3"
FT                   /protein_id="ABW25525.1"
FT                   /translation="MTEDFVTSSPQHSQSWQQAILDSADFVIVSTDINGLIQTLNAGAL
FT                   KQFGYSPEEIIDRVTPIIFHDPEEVEQRAQVLSHELGHAIEPGMETLIVKARMGMVDEN
FT                   IWTLIRKDHSRFPVRLSVTALRNDLGHLTGFLGIGKDITAQQAAEASLVESEARFSAAF
FT                   QNAPIGMALVSPSGQCLRVNHALAHLLGYPQTKLMDLILTEMIHPKDRSIEETNRLRLV
FT                   AREIGNYCLELRCLHQQGHEVWVLMNVSLVNGQEVYPPYCIVQVQDITRRKQAEAQLQR
FT                   LNANLEQLVEERTRQLKEAIETTEIANQAKSRFIANMSHEFRTPLNGIMGFSQLLLQDR
FT                   RITSDQQSNLNVILRSGEHLLSLVNEVITLSKIEAGMLAYESKDVNLHHLCEGVEDLLS
FT                   LQANSKDIQFQIHIAPDVPQYVRTDAKKLRQILINLLGNALKFTKRGSVVCQVQWRPSA
FT                   PERSAHELHFIIQDTGPGIPGHLLPQLFEPFAQDPLNRETFGGIGLGLTICQRFIHLMK
FT                   GDISIESVEGQGTTVSFYIQVESGEPVLEPAISETTVEGLAENTPSYRVLVVEDYPDNR
FT                   EILLMMLEVVGFEVKEAVNGQEAVDLNRTWQPHLIWMDLQLPVLNGLEATQLIKSQNPN
FT                   PPVIIAITAQALESDEVKALKAGCDDYLRKPYQAAQVFEKMAQHLDITYRYKTSNSSHT
FT                   SADPISLSADELANMPPSWIQLLYDAAIMLDEDMLDLLLRDIPDDQHSLKSSLEYLMAT
FT                   YQYDVIMEKAQAVLR"
     MTEDFVTSSP QHSQSWQQAI LDSADFVIVS TDINGLIQTL NAGALKQFGY SPEEIIDRVT        60
     PIIFHDPEEV EQRAQVLSHE LGHAIEPGME TLIVKARMGM VDENIWTLIR KDHSRFPVRL       120
     SVTALRNDLG HLTGFLGIGK DITAQQAAEA SLVESEARFS AAFQNAPIGM ALVSPSGQCL       180
     RVNHALAHLL GYPQTKLMDL ILTEMIHPKD RSIEETNRLR LVAREIGNYC LELRCLHQQG       240
     HEVWVLMNVS LVNGQEVYPP YCIVQVQDIT RRKQAEAQLQ RLNANLEQLV EERTRQLKEA       300
     IETTEIANQA KSRFIANMSH EFRTPLNGIM GFSQLLLQDR RITSDQQSNL NVILRSGEHL       360
     LSLVNEVITL SKIEAGMLAY ESKDVNLHHL CEGVEDLLSL QANSKDIQFQ IHIAPDVPQY       420
     VRTDAKKLRQ ILINLLGNAL KFTKRGSVVC QVQWRPSAPE RSAHELHFII QDTGPGIPGH       480
     LLPQLFEPFA QDPLNRETFG GIGLGLTICQ RFIHLMKGDI SIESVEGQGT TVSFYIQVES       540
     GEPVLEPAIS ETTVEGLAEN TPSYRVLVVE DYPDNREILL MMLEVVGFEV KEAVNGQEAV       600
     DLNRTWQPHL IWMDLQLPVL NGLEATQLIK SQNPNPPVII AITAQALESD EVKALKAGCD       660
     DYLRKPYQAA QVFEKMAQHL DITYRYKTSN SSHTSADPIS LSADELANMP PSWIQLLYDA       720
     AIMLDEDMLD LLLRDIPDDQ HSLKSSLEYL MATYQYDVIM EKAQAVLR                    768
//

If you have problems or comments...

PBIL Back to PBIL home page