(data stored in ACNUC8465 zone)

EMBL: CP000828.PE437

CP000828.PE437       Location/Qualifiers
FT   CDS             complement(453563..453907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0472"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25528"
FT                   /db_xref="InterPro:IPR015102"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0CBY6"
FT                   /protein_id="ABW25528.1"
FT                   /translation="MILQDVQDFIHNGHLVSLAEMEQHFHIEGQALQAMIHKLIRKGRV
FT                   RQAPVPTKCHGCTFCDGHALTFYEWVDEQNRPEPHHGSRCSIPCCQDQPIHSLEPELFN
FT                   QYGSTSKKFG"
     MILQDVQDFI HNGHLVSLAE MEQHFHIEGQ ALQAMIHKLI RKGRVRQAPV PTKCHGCTFC        60
     DGHALTFYEW VDEQNRPEPH HGSRCSIPCC QDQPIHSLEP ELFNQYGSTS KKFG             114
//

If you have problems or comments...

PBIL Back to PBIL home page