(data stored in ACNUC27125 zone)

EMBL: CP000828.PE44

CP000828.PE44        Location/Qualifiers
FT   CDS             46449..46976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0047"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25135"
FT                   /db_xref="GOA:B0C523"
FT                   /db_xref="InterPro:IPR018639"
FT                   /db_xref="UniProtKB/TrEMBL:B0C523"
FT                   /protein_id="ABW25135.1"
FT                   /translation="MRQPHQRSHRKRFLRRTKFHRKKLTWKRRGRYLYLRFIRLQGSPD
FT                   AIARGLSVGAFAGMFPIFGFQIIFGVFLAACVRGNKLTAAAATWISNPFTYLPLFAFNF
FT                   HLGQWLLQANEFDFDQLQKLDWQGLLALGPGFIATWFTGCFVMGCLAAIIGYLLGLWLI
FT                   QHLRKKHRSQRS"
     MRQPHQRSHR KRFLRRTKFH RKKLTWKRRG RYLYLRFIRL QGSPDAIARG LSVGAFAGMF        60
     PIFGFQIIFG VFLAACVRGN KLTAAAATWI SNPFTYLPLF AFNFHLGQWL LQANEFDFDQ       120
     LQKLDWQGLL ALGPGFIATW FTGCFVMGCL AAIIGYLLGL WLIQHLRKKH RSQRS            175
//

If you have problems or comments...

PBIL Back to PBIL home page