(data stored in ACNUC27125 zone)

EMBL: CP000828.PE441

CP000828.PE441       Location/Qualifiers
FT   CDS             458789..458902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25532"
FT                   /db_xref="UniProtKB/TrEMBL:B0CBZ0"
FT                   /protein_id="ABW25532.1"
FT                   /translation="MELFSYGKVASADIANHLVFGGLLLDLAIHSREIPRN"
     MELFSYGKVA SADIANHLVF GGLLLDLAIH SREIPRN                                 37
//

If you have problems or comments...

PBIL Back to PBIL home page