(data stored in ACNUC27125 zone)

EMBL: CP000828.PE443

CP000828.PE443       Location/Qualifiers
FT   CDS             complement(460374..461066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0480"
FT                   /product="cyclic nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25534"
FT                   /db_xref="GOA:B0CBZ2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0CBZ2"
FT                   /protein_id="ABW25534.1"
FT                   /translation="MIDTANVADWLEITVIFRGLSAEQRQALTQIAQIQSFKKGEQIFR
FT                   QDQEATGFYVVKSGRVKVFQMSANGKEQILNIFTEGDNFADVPALDGQAFPASAAALEP
FT                   ADLIFFPRYPFLEFLHHNPDVAVQMLISLSSHLRHLAQLVEQLSFKSVPQRLATYLLSL
FT                   GDTASDTVYLDLTKSQLAARLGTIPATLSRAFYQLSSDGMIAIAGPKVTILDRDRLTAL
FT                   SQSPESSE"
     MIDTANVADW LEITVIFRGL SAEQRQALTQ IAQIQSFKKG EQIFRQDQEA TGFYVVKSGR        60
     VKVFQMSANG KEQILNIFTE GDNFADVPAL DGQAFPASAA ALEPADLIFF PRYPFLEFLH       120
     HNPDVAVQML ISLSSHLRHL AQLVEQLSFK SVPQRLATYL LSLGDTASDT VYLDLTKSQL       180
     AARLGTIPAT LSRAFYQLSS DGMIAIAGPK VTILDRDRLT ALSQSPESSE                  230
//

If you have problems or comments...

PBIL Back to PBIL home page