(data stored in ACNUC8465 zone)

EMBL: CP000828.PE446

CP000828.PE446       Location/Qualifiers
FT   CDS             464205..464870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0483"
FT                   /product="alternative oxidase, putative"
FT                   /note="Disrupted reading frame. Sequence has been checked.
FT                   Possible pseudogene."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25537"
FT                   /db_xref="GOA:B0CBZ5"
FT                   /db_xref="InterPro:IPR002680"
FT                   /db_xref="InterPro:IPR038659"
FT                   /db_xref="UniProtKB/TrEMBL:B0CBZ5"
FT                   /protein_id="ABW25537.1"
FT                   /translation="MAFWCFSSIKIYANRPYPRFYVLETVARVPYFSYLSVLHLYETLG
FT                   LWRKADWLKIHFAESWNELHHLLIMESLGGAEFWGDRLLAKTTALIYYWVIAALYVVSP
FT                   RSAYHFMELVEEHAYASYDKFLQSEAEHLKTLPAPDVAIQYYQDGDLYMFDEFQTAHQA
FT                   AERRPQVDTLYDVFVAIRDDEMEHVKTILACQQPEAQQALLSPHTPPALTTEDTPVVS"
     MAFWCFSSIK IYANRPYPRF YVLETVARVP YFSYLSVLHL YETLGLWRKA DWLKIHFAES        60
     WNELHHLLIM ESLGGAEFWG DRLLAKTTAL IYYWVIAALY VVSPRSAYHF MELVEEHAYA       120
     SYDKFLQSEA EHLKTLPAPD VAIQYYQDGD LYMFDEFQTA HQAAERRPQV DTLYDVFVAI       180
     RDDEMEHVKT ILACQQPEAQ QALLSPHTPP ALTTEDTPVV S                           221
//

If you have problems or comments...

PBIL Back to PBIL home page