(data stored in ACNUC5340 zone)

EMBL: CP000828.PE454

CP000828.PE454       Location/Qualifiers
FT   CDS             470869..471030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0492"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25545"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC03"
FT                   /protein_id="ABW25545.1"
FT                   /translation="MAFNTCVSVIRSASHKAQMIHNQDVQAVSTDVINADELWSFVKKS
FT                   KSTVNRKS"
     MAFNTCVSVI RSASHKAQMI HNQDVQAVST DVINADELWS FVKKSKSTVN RKS               53
//

If you have problems or comments...

PBIL Back to PBIL home page