(data stored in ACNUC8465 zone)

EMBL: CP000828.PE455

CP000828.PE455       Location/Qualifiers
FT   CDS             471054..471482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0494"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25546"
FT                   /db_xref="GOA:B0CC04"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC04"
FT                   /protein_id="ABW25546.1"
FT                   /translation="MSLAKDSGLVLGGRIGKHTDELAQELMENTEGKTACHHWQTDGWE
FT                   GYSRQLPNETIHHVSKALTQRLERTNGILRQQAGRWHRRQNKFGKVWQQRAVTLRLVLT
FT                   YFNWIWCHSRFKNTAAQRAGLAEHPWQWQDLVNYPTLY"
     MSLAKDSGLV LGGRIGKHTD ELAQELMENT EGKTACHHWQ TDGWEGYSRQ LPNETIHHVS        60
     KALTQRLERT NGILRQQAGR WHRRQNKFGK VWQQRAVTLR LVLTYFNWIW CHSRFKNTAA       120
     QRAGLAEHPW QWQDLVNYPT LY                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page