(data stored in ACNUC27125 zone)

EMBL: CP000828.PE456

CP000828.PE456       Location/Qualifiers
FT   CDS             complement(471460..471831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25547"
FT                   /db_xref="GOA:B0CC05"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC05"
FT                   /protein_id="ABW25547.1"
FT                   /translation="MIYHTSSSQPSNVSQSLLGRFLKFLRHPRYTVNVATEHHGIVDVL
FT                   RLYALALVMVLPLGVLSSRLAENLESSNKVLEFAQTVSFWQIILFAVILAPLWEETVFR
FT                   LPLRYTPINRLCVNKVWDS"
     MIYHTSSSQP SNVSQSLLGR FLKFLRHPRY TVNVATEHHG IVDVLRLYAL ALVMVLPLGV        60
     LSSRLAENLE SSNKVLEFAQ TVSFWQIILF AVILAPLWEE TVFRLPLRYT PINRLCVNKV       120
     WDS                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page