(data stored in ACNUC5340 zone)

EMBL: CP000828.PE460

CP000828.PE460       Location/Qualifiers
FT   CDS             complement(474372..475103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0498"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /note="Upstream region overlaps with a putative
FT                   transposase."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25551"
FT                   /db_xref="GOA:B0C653"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:B0C653"
FT                   /protein_id="ABW25551.1"
FT                   /translation="MLTHWESIESQAMQENWSYAEFLLALCETKAQRREQARLKRALTE
FT                   ARLPNAKSFTNFDFSHCPQLNPAPLMQLAADPGWLERAENCLILGPSGVGKTHLATGVS
FT                   KKMLEFGKRVKFFAANALVQHLQQAKLQLQLHPMLKKLDRYDLLVLDDLGYCKKSEAET
FT                   SVLFELIAHRYERKSLLITANQPFSQWDDIFTDSMMAVAAIDRLIHHGLIIKIQADSYR
FT                   RKSATQRTAQTQSPPQKSQSK"
     MLTHWESIES QAMQENWSYA EFLLALCETK AQRREQARLK RALTEARLPN AKSFTNFDFS        60
     HCPQLNPAPL MQLAADPGWL ERAENCLILG PSGVGKTHLA TGVSKKMLEF GKRVKFFAAN       120
     ALVQHLQQAK LQLQLHPMLK KLDRYDLLVL DDLGYCKKSE AETSVLFELI AHRYERKSLL       180
     ITANQPFSQW DDIFTDSMMA VAAIDRLIHH GLIIKIQADS YRRKSATQRT AQTQSPPQKS       240
     QSK                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page