(data stored in ACNUC27125 zone)

EMBL: CP000828.PE461

CP000828.PE461       Location/Qualifiers
FT   CDS             complement(474931..476667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0499"
FT                   /product="transposase, putative"
FT                   /note="Downstream region overlaps with a putative
FT                   transposase-associated ATP-binding protein."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25552"
FT                   /db_xref="GOA:B0CC10"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC10"
FT                   /protein_id="ABW25552.1"
FT                   /translation="MPNKRIDSYHTRVYMNGRDLGLKQAEAAYIAEISTRTGQRIEAGT
FT                   HQPNRGRLQDQRTVPDPLADVWEDELEPMLRRDPRLKPMTLYEYLQDKYPGQYPQVLRT
FT                   LQRRVRTWKALHGPSPEVMFELRHEPGVQGFSGFTELKGITITIAGQPFEHLIYHYRLG
FT                   YSGWRYAQIIQGGESFVALSEGLQNAFAACGGVPQQHRTDSLSAAYRNMGGRRSKNLTR
FT                   LYDELCDHYRLEPTRNNKGIAHENGSIESPHGHLKNRIKQAIYLRGSADFTSVAEYQAL
FT                   IDAQVAKLNQQCQTKYEQEKDHLQPLPKYRTPDYEVLTAKVSKRSTIDVRCILYTVPSR
FT                   LIGRQLELHLYHDRIVGYLERHPVVELPRKRVSGKGKRRDRCINYRHVIGSMRLKPRAF
FT                   IYCTWQSDLLPNPEYRQIWEQLKAQFDLEQAAKIIVEALYIAAVQDKEQAVAVYLQQQL
FT                   QASSLTLNRLKKQFEPPQMKQVPDLSIEQHSLELYDKLLPSCSVPAEPLPAPEPLSKKA
FT                   QALPHVDPLGIYRIPSYAGKLVLCGILTSLVRNEGPKKRTSSAKTCSHRSQAPKRKKFY
FT                   QL"
     MPNKRIDSYH TRVYMNGRDL GLKQAEAAYI AEISTRTGQR IEAGTHQPNR GRLQDQRTVP        60
     DPLADVWEDE LEPMLRRDPR LKPMTLYEYL QDKYPGQYPQ VLRTLQRRVR TWKALHGPSP       120
     EVMFELRHEP GVQGFSGFTE LKGITITIAG QPFEHLIYHY RLGYSGWRYA QIIQGGESFV       180
     ALSEGLQNAF AACGGVPQQH RTDSLSAAYR NMGGRRSKNL TRLYDELCDH YRLEPTRNNK       240
     GIAHENGSIE SPHGHLKNRI KQAIYLRGSA DFTSVAEYQA LIDAQVAKLN QQCQTKYEQE       300
     KDHLQPLPKY RTPDYEVLTA KVSKRSTIDV RCILYTVPSR LIGRQLELHL YHDRIVGYLE       360
     RHPVVELPRK RVSGKGKRRD RCINYRHVIG SMRLKPRAFI YCTWQSDLLP NPEYRQIWEQ       420
     LKAQFDLEQA AKIIVEALYI AAVQDKEQAV AVYLQQQLQA SSLTLNRLKK QFEPPQMKQV       480
     PDLSIEQHSL ELYDKLLPSC SVPAEPLPAP EPLSKKAQAL PHVDPLGIYR IPSYAGKLVL       540
     CGILTSLVRN EGPKKRTSSA KTCSHRSQAP KRKKFYQL                               578
//

If you have problems or comments...

PBIL Back to PBIL home page